The domain within your query sequence starts at position 30 and ends at position 140; the E-value for the SSB domain shown below is 1.6e-34.

LNRVQLLGRVGQDPVMRQVEGKNPVTIFSLATNEMWRSGDSEVYQMGDVSQKTTWHRISV
FRPGLRDVAYQYVKKGARIFVEGKVDYGEYMDKNNVRRQATTIIADNIIFL

SSB

SSB
PFAM accession number:PF00436
Interpro abstract (IPR000424):

The Escherichia coli single-strand binding protein [(PUBMED:2087220)] (gene ssb), also known as the helix-destabilising protein, is a protein of 177 amino acids. It binds tightly, as a homotetramer, to single-stranded DNA (ss-DNA) and plays an important role in DNA replication, recombination and repair. Closely related variants of SSB are encoded in the genome of a variety of large self-transmissible plasmids. SSB has also been characterized in bacteria such as Proteus mirabilis or Serratia marcescens. Eukaryotic mitochondrial proteins that bind ss-DNA and are probably involved in mitochondrial DNA replication are structurally and evolutionary related to prokaryotic SSB.

Primosomal replication protein N (PriB) is a specialist protein from bacteria that binds single-stranded DNA at the primosome assembly site (PAS). The primosome is a mobile multiprotein replication priming complex which is believe to operate on the lagging-strand template at the E. coli DNA replication fork [(PUBMED:1856227)]. The primosome consists of one monomer of PriC and DnaT, two monomers of PriA, two dimers of PriB and one hexamer of DnaB [(PUBMED:8663106)].

GO function:single-stranded DNA binding (GO:0003697)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SSB