The domain within your query sequence starts at position 806 and ends at position 916; the E-value for the SSFA2_C domain shown below is 3e-14.
CRHSLYSQAEDPKVQFMKTLKILQDTTVRDLCSCTVYEMETMKMVCQSFREHLEEIEQHF MGQQALYPRDMSEEEREEAEYLRTLREALRQQVAELAFQLGDRARQIKEGI
SSFA2_C |
---|
PFAM accession number: | PF14723 |
---|---|
Interpro abstract (IPR029326): | This domain is found at the C terminus of the actin-interacting protein sperm-specific antigen 2 [ (PUBMED:14673706) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SSFA2_C