The domain within your query sequence starts at position 806 and ends at position 916; the E-value for the SSFA2_C domain shown below is 3e-14.

CRHSLYSQAEDPKVQFMKTLKILQDTTVRDLCSCTVYEMETMKMVCQSFREHLEEIEQHF
MGQQALYPRDMSEEEREEAEYLRTLREALRQQVAELAFQLGDRARQIKEGI

SSFA2_C

SSFA2_C
PFAM accession number:PF14723
Interpro abstract (IPR029326):

This domain is found at the C terminus of the actin-interacting protein sperm-specific antigen 2 [(PUBMED:14673706)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SSFA2_C