The domain within your query sequence starts at position 74 and ends at position 285; the E-value for the SSrecog domain shown below is 5.7e-106.
YDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLSFDIGDQPVFEIPL SNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQ ATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQM FFVISLDPPIKQGQTRYHFLILLFSKDEDISL
SSrecog |
---|
PFAM accession number: | PF03531 |
---|---|
Interpro abstract (IPR024954): | This domain is found in structure-specific recognition protein SSRP1 (POB3 in yeast) and related proteins, which are components of the FACT complex - a general chromatin factor that acts to reorganise nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair [ (PUBMED:14585989) (PUBMED:10924459) ]. During transcription elongation the FACT complex acts as a histone chaperone that both destabilises and restores nucleosomal structure [ (PUBMED:9489704) (PUBMED:12934006) ]. This domain has a Pleckstrin homology fold. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SSrecog