The domain within your query sequence starts at position 74 and ends at position 285; the E-value for the SSrecog domain shown below is 5.7e-106.

YDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLSFDIGDQPVFEIPL
SNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQ
ATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQM
FFVISLDPPIKQGQTRYHFLILLFSKDEDISL

SSrecog

SSrecog
PFAM accession number:PF03531
Interpro abstract (IPR024954):

This domain is found in structure-specific recognition protein SSRP1 (POB3 in yeast) and related proteins, which are components of the FACT complex - a general chromatin factor that acts to reorganise nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair [(PUBMED:14585989), (PUBMED:10924459)]. During transcription elongation the FACT complex acts as a histone chaperone that both destabilises and restores nucleosomal structure [(PUBMED:9489704), (PUBMED:12934006)].

This domain has a Pleckstrin homology fold.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SSrecog