The domain within your query sequence starts at position 16 and ends at position 448; the E-value for the ST7 domain shown below is 2.5e-278.

IVWSWTYLWTVWFFLVLFLVYILRVPLRINDNLSTVSMFLNTLTPKFYVALTGTSSLISG
LILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSECKV
WRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAIMQKAWR
ERNPQARISAAHEALEINECATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQ
HHGSQYEAQHRRDTNVLVYIKRRLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENL
LEALLELQAYADVQAVLAKYDDISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTA
EMNAVEAIHRAVEFNPHVPKYLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGA
LNLLHCTWEGTFH

ST7

ST7
PFAM accession number:PF04184
Interpro abstract (IPR007311): The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene. The molecular function of this protein is uncertain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ST7