The domain within your query sequence starts at position 188 and ends at position 301; the E-value for the STAG domain shown below is 3.1e-38.

GDYPLTAPGPSWKKFQGSFCEFVKTLVYQCQYSLLYDGFPMDDLISLLIGLSDSQVRAFR
HTSTLAAMKLMTSLVKVALQLSLHKDNNQRQYEAERNKGPEQRAPERLESLLEK

STAG

STAG
PFAM accession number:PF08514
Interpro abstract (IPR013721):

STAG domain proteins are subunits of cohesin complex - a protein complex required for sister chromatid cohesion in eukaryotes. The STAG domain is present in Schizosaccharomyces pombe (Fission yeast) mitotic cohesin Psc3, and the meiosis specific cohesin Rec11. Many organisms express a meiosis-specific STAG protein, for example, mice and humans have a meiosis specific variant called STAG3, although budding yeast does not have a meiosis specific version [(PUBMED:16043696)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry STAG