The domain within your query sequence starts at position 34 and ends at position 260; the E-value for the STG domain shown below is 4.8e-85.
EKASPHSGQPSFTSLLNPGQPQPKPDPVNNELLGVLPRLSESPQDGALPEGGSEVPNGPP FWGPPPMESWPSEDPQQGMAAVAEDQLEQMLPEALPYLSRGGRLPEASSARLRQPSLAAS YPQDSEAGLQPGSSSLETEAEAFARSPFWFLIHKLLPGSSGRILRPGTSWGSGGAGTGWG TRPMPYPSGIWGSNGLVSGTSLGGRGPYPVRIWGRNGWYPLRILGGN
STG |
![]() |
---|
PFAM accession number: | PF15809 |
---|---|
Interpro abstract (IPR026135): | Uncharacterised protein C6orf15 (also known as STG) was initially isolated in rhesus monkey taste buds [ (PUBMED:11178745) ]. The human homologue is also expressed in skin and tonsils [ (PUBMED:15217361) ]. In mice, C6orf15 has been shown to be secreted into the extracellular matrix where it binds to a number of different extracellular matrix proteins [ (PUBMED:18757743) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry STG