The domain within your query sequence starts at position 34 and ends at position 260; the E-value for the STG domain shown below is 4.8e-85.

EKASPHSGQPSFTSLLNPGQPQPKPDPVNNELLGVLPRLSESPQDGALPEGGSEVPNGPP
FWGPPPMESWPSEDPQQGMAAVAEDQLEQMLPEALPYLSRGGRLPEASSARLRQPSLAAS
YPQDSEAGLQPGSSSLETEAEAFARSPFWFLIHKLLPGSSGRILRPGTSWGSGGAGTGWG
TRPMPYPSGIWGSNGLVSGTSLGGRGPYPVRIWGRNGWYPLRILGGN

STG

STG
PFAM accession number:PF15809
Interpro abstract (IPR026135): Uncharacterised protein C6orf15 (also known as STG) was initially isolated in rhesus monkey taste buds [(PUBMED:11178745)]. The human homologue is also expressed in skin and tonsils [(PUBMED:15217361)]. In mice, C6orf15 has been shown to be secreted into the extracellular matrix where it binds to a number of different extracellular matrix proteins [(PUBMED:18757743)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry STG