The domain within your query sequence starts at position 22 and ends at position 392; the E-value for the STIL_N domain shown below is 6.6e-166.

LWNPMPIGECIYLHLSYYRKPKLMVTEKAIRLAYRHAKQNKKNVPCFLLGSLTVDEDEEG
VTLTIDRFDPGREIPECLERTPTASLPGDFLIPCRVHIQGLGSRDVIVHNADDFSSALKA
LQYHVCSKDFLDCGKLLCLRAQITPRESLDGVDFNLQWTAVTLANSFKCVPVKPIPIIPT
ALARNLSSNLNISQVQGTYKHGYITMDETRKLLLLLQSDPKVSSLPLVGIWLAGIIHVYS
PQVWACCLRYMFSSSIQERVFSESGNFIIVLYSLTHKEPEFYECLPCESRTPDLQFQLLT
NKETLHLFNNVEPSGKNPIHFELSAESQDAEAEAEVLSKISKTLPVKRAISWDPSVQNLS
LRSTLKSQTIA

STIL_N

STIL_N
PFAM accession number:PF15253
Interpro abstract (IPR026123):

SIL (also called STIL/TAL1 interrupting locus) is an immediate-early gene that is essential for embryonic development and is implicated in T-cell leukemia-associated translocations [(PUBMED:12006978), (PUBMED:8825637)]. Sil protein is necessary for proper mitotic spindle organisation in zebrafish and human cells and localizes to the mitotic spindle poles only during metaphase [(PUBMED:17576815)]. Mouse Sil was suggested to play a role as a positive regulator of the sonic hedgehog pathway, acting downstream of PTCH1 [(PUBMED:11668681)]. In human, cell cycle-dependent phosphorylation of Sil is required for its interaction with Pin1, a regulator of mitosis [(PUBMED:16024801)].

Primary microcephaly (MCPH) is an autosomal-recessive congenital disorder characterised by smaller-than-normal brain size and mental retardation. Three different homozygous mutations in SIL were identified in patients from three of the five families linked to the MCPH7 locus; all are predicted to truncate the Sil protein [(PUBMED:19215732)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry STIL_N