The domain within your query sequence starts at position 64 and ends at position 241; the E-value for the SUFU domain shown below is 4.9e-54.
GPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFR LKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLTEDP QMQPVRTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRG
SUFU |
![]() |
---|
PFAM accession number: | PF05076 |
---|---|
Interpro abstract (IPR020941): | Sufu, encoding the human ortholog of Drosophila suppressor of fused, appears to have a conserved role in the repression of Hedgehog signalling. It is a repressor of the Gli and Ci transcription factors of the Hedgehog signalling cascade [ (PUBMED:12150819) ], and functions by binding these proteins and preventing their translocation to the nucleus. Sufu has been found to be a tumour-suppressor gene that predisposes individuals to medulloblastoma by modulating the SHH signalling pathway [ (PUBMED:12068298) ]. Homologues of Sufu have been found in bacteria, though their function is not currently known. This entry represents a domain found in Sufu and its homologues. It is also found in other proteins that are functionally uncharacterised. In eukaryotic Sufu, an additional domain is found at the C terminus of the protein. This domain binds to the C-terminal domain of the Gli/Ci transcription factors, inhibiting their activity [ (PUBMED:15367681) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUFU