The domain within your query sequence starts at position 254 and ends at position 474; the E-value for the SUFU_C domain shown below is 2.3e-89.
ERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDEEDSRSICLGTQPRRLSGKDTEQIRETL RRGLEINSKPVLPPINSQRQNGLTHDRAPSRKDSLGSDSSTAIIPHELIRTRQLESVHLK FNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATEEHPYAAHGPWLQ ILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSI
SUFU_C |
![]() |
---|
PFAM accession number: | PF12470 |
---|---|
Interpro abstract (IPR024314): | This entry represents the C-terminal domain of eukaryotic suppressor of fused (Sufu) proteins; it is not present in bacterial homologues. Sufu is a repressor of the Gli and Ci transcription factors of the Hedgehog signalling cascade. It functions by binding to these proteins and preventing their translocation to the nucleus. The Sufu C-terminal domain binds to the N-terminal of Gli/Ci, while the N-terminal of Sufu binds to the C-terminal of Gli/Ci. This dual binding mechanism is likely to be an evolutionary advancement in this signalling cascade, which is not present in bacterial homologues [ (PUBMED:15367681) ]. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUFU_C