The domain within your query sequence starts at position 132 and ends at position 207; the E-value for the SURF6 domain shown below is 1.6e-9.

TKELSAATLEKRQRRKQERERKKRKRKERQAKQQVAEAEKKEEPVEVTPKMACKELQESG
LIFNKVDLFSLRPARA

SURF6

SURF6
PFAM accession number:PF04935
Interpro abstract (IPR029190):

This entry represents the C-terminal domain of the ribosomal RNA-processing protein 14 (Rrp14), which shares protein sequence similarity with surfeit locus protein 6 (SURF6).

In mammals, SURF6 is a component of the nucleolar matrix and has a strong binding capacity for nucleic acids [ (PUBMED:9548374) ]. SURF6 is always found in the nucleolus regardless of the phase of the cell cycle suggesting that it is a structural protein constitutively present in nucleolar substructures. A role in rRNA processing has been proposed for this protein.

Saccharomyces cerevisiae member of the SURF-6 family, named Rrp14 (ribosomal RNA-processing protein 14), interacts with proteins involved in ribosomal biogenesis and cell polarity [ (PUBMED:15629442) ]. It is required for the synthesis of both 40S and 60S ribosomal subunits and may also play some direct role in correct positioning of the mitotic spindle during mitosis [ (PUBMED:17272295) (PUBMED:17804645) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SURF6