The domain within your query sequence starts at position 625 and ends at position 672; the E-value for the SUV3_C domain shown below is 4e-19.

LMDLEAVHDVFDLYLWLSYRFIDMFPDSSLVRSLQKELDAIIQEGVHN

SUV3_C

SUV3_C
PFAM accession number:PF12513
Interpro abstract (IPR022192):

This domain is found in ATP-dependent RNA helicase SUV3. It is found in bacterial and eukaryotic proteins, it is approximately 50 amino acids in length and it is usually found in association with.

The yeast mitochondrial degradosome (mtEXO) is an NTP-dependent exoribonuclease involved in mitochondrial RNA metabolism. mtEXO is made up of two subunits: an RNase (DSS1) and an RNA helicase (SUV3). These co-purify with mitochondrial ribosomes [(PUBMED:12426313)].

GO function:hydrolase activity, acting on acid anhydrides (GO:0016817)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUV3_C