The domain within your query sequence starts at position 625 and ends at position 672; the E-value for the SUV3_C domain shown below is 4e-19.
LMDLEAVHDVFDLYLWLSYRFIDMFPDSSLVRSLQKELDAIIQEGVHN
SUV3_C |
---|
PFAM accession number: | PF12513 |
---|---|
Interpro abstract (IPR022192): | This domain is found in ATP-dependent RNA helicase SUV3. It is found in bacterial and eukaryotic proteins, it is approximately 50 amino acids in length and it is usually found in association with . The yeast mitochondrial degradosome (mtEXO) is an NTP-dependent exoribonuclease involved in mitochondrial RNA metabolism. mtEXO is made up of two subunits: an RNase (DSS1) and an RNA helicase (SUV3). These co-purify with mitochondrial ribosomes [ (PUBMED:12426313) ]. |
GO function: | hydrolase activity, acting on acid anhydrides (GO:0016817) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUV3_C