The domain within your query sequence starts at position 193 and ends at position 246; the E-value for the SUZ domain shown below is 2.6e-11.

DFQKRYILKRDNSSFDKDDSQMRIRLKDDRRSKSIEEREEEYQRARDRIFSQDS

SUZ

SUZ
PFAM accession number:PF12752
Interpro abstract (IPR024771):

The SUZ domain is a conserved RNA-binding domain found in eukaryotes and enriched in positively charged amino acids. It was first characterised in the Caenorhabditis elegans protein SZY-20 where it has been shown to bind RNA and allow their localization to the centrosome [(PUBMED:19081077)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUZ