The domain within your query sequence starts at position 250 and ends at position 303; the E-value for the SUZ domain shown below is 7.4e-14.
EFQQRFILKRDDASMDRDDNQMRVPLQDGRRSKSIEEREEEYQRVRERIFARET
SUZ |
---|
PFAM accession number: | PF12752 |
---|---|
Interpro abstract (IPR024771): | The SUZ domain is a conserved RNA-binding domain found in eukaryotes and enriched in positively charged amino acids. It was first characterised in the Caenorhabditis elegans protein SZY-20 where it has been shown to bind RNA and allow their localization to the centrosome [ (PUBMED:19081077) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUZ