SMART: Pfam domain SUZ-C

The domain within your query sequence starts at position 453 and ends at position 483; the E-value for the SUZ-C domain shown below is 1.6e-10.

LLSRRMQTADGLPVGVLRLPRGPDNTRGFHG

SUZ-C

PFAM accession number:	PF12901
Interpro abstract (IPR024642):	The SUZ-C domain is a conserved motif found in one or more copies in several RNA-binding proteins [ (PUBMED:19081077) ]. It is always found at the C terminus of the protein and appears to be required for localization of the protein to specific subcellular structures. The domain was first characterised in the C.elegans protein SZY-20 which localizes to the centrosome. This domain is widely distributed in eukaryotes.

PFAM accession number:

PF12901

Interpro abstract (IPR024642):

The SUZ-C domain is a conserved motif found in one or more copies in several RNA-binding proteins [ (PUBMED:19081077) ]. It is always found at the C terminus of the protein and appears to be required for localization of the protein to specific subcellular structures. The domain was first characterised in the C.elegans protein SZY-20 which localizes to the centrosome. This domain is widely distributed in eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUZ-C