The domain within your query sequence starts at position 725 and ends at position 758; the E-value for the SUZ-C domain shown below is 5.4e-16.
RLKNITLDDASAPRLMVLRQPRGPDNSMGFGAER
SUZ-C |
---|
PFAM accession number: | PF12901 |
---|---|
Interpro abstract (IPR024642): | The SUZ-C domain is a conserved motif found in one or more copies in several RNA-binding proteins [ (PUBMED:19081077) ]. It is always found at the C terminus of the protein and appears to be required for localization of the protein to specific subcellular structures. The domain was first characterised in the C.elegans protein SZY-20 which localizes to the centrosome. This domain is widely distributed in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUZ-C