The domain within your query sequence starts at position 99 and ends at position 132; the E-value for the SUZ-C domain shown below is 2.2e-15.

RPTRISQPEDSRQPSNVIRQPLGPDGSQGFKQRR

SUZ-C

SUZ-C
PFAM accession number:PF12901
Interpro abstract (IPR024642):

The SUZ-C domain is a conserved motif found in one or more copies in several RNA-binding proteins [(PUBMED:19081077)]. It is always found at the C terminus of the protein and appears to be required for localization of the protein to specific subcellular structures. The domain was first characterised in the C.elegans protein SZY-20 which localizes to the centrosome. This domain is widely distributed in eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUZ-C