The domain within your query sequence starts at position 1 and ends at position 73; the E-value for the SVIP domain shown below is 1.5e-27.
MGLCFPCPAESAPPSPSPEEKREKLAEAAERRQKEAATRGILDIQSVEAKKKKKEQLEKQ MATSGPPTAGGLR
SVIP |
---|
PFAM accession number: | PF15811 |
---|---|
Interpro abstract (IPR031632): | SVIP, small VCP/p97-interacting protein, was identified by yeast two-hybrid screening to be an interactive partner of VCP/p97. Mammalian VCP/p97 and its yeast counterpart Cdc48 participate in the formation of organelles, including the endoplasmic reticulum (ER), Golgi apparatus, and nuclear envelope. Over-expression of SVIP caused the formation of large vacuoles that seemed to be derived from the ER [ (PUBMED:12529442) ]. Proteins in this family have two putative coiled-coil regions and are approximately 80 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SVIP