The domain within your query sequence starts at position 424 and ends at position 512; the E-value for the SWIRM domain shown below is 3.9e-38.

IIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTS
TACRRNLAGDVCAIMRVHAFLEQWGLINY

SWIRM

SWIRM
PFAM accession number:PF04433
Interpro abstract (IPR007526):

The SWIRM domain is a small alpha-helical domain of about 85 amino acid residues found in eukaryotic chromosomal proteins. It is named after the proteins SWI3, RSC8 and MOIRA in which it was first recognised. This domain is predicted to mediate protein-protein interactions in the assembly of chromatin-protein complexes [(PUBMED:12186646)].

The SWIRM domain can be linked to different domains, such as the ZZ-type zinc finger (IPR000433), the Myb DNA-binding domain (IPR001005), the HORMA domain (IPR003511), the amino-oxidase domain, the chromo domain (IPR000953), and the JAB1/PAD1 domain.

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SWIRM