The domain within your query sequence starts at position 705 and ends at position 771; the E-value for the SWIRM-assoc_3 domain shown below is 9.6e-35.

VDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGT
GPDEPEK

SWIRM-assoc_3

SWIRM-assoc_3
PFAM accession number:PF16498
Interpro abstract (IPR032448):

This conserved domain can be found after the SWIRM and SANT domains in SWI/SNF complex subunits SMARCC1 (BAF155) and SMARCC2 (BAF170) [(PUBMED:23996527)]. The function of this domain is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SWIRM-assoc_3