The domain within your query sequence starts at position 45 and ends at position 135; the E-value for the SYCE1 domain shown below is 4.4e-39.

GSLEPQIEDLIHRINELQQGPAKKRSSEELGEAQALQEAMHRELDSLNEERVHLEEVLRK
KQEAVSILKKHPQERDSDTPQKCTVQFSGFR

SYCE1

SYCE1
PFAM accession number:PF15233
Interpro abstract (IPR026676): Synaptonemal complex central element protein 1 is a major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. It requires the transverse filament protein-SYCP1 in order to be incorporated into the central element. It may have a role in the synaptonemal complex assembly, stabilisation and recombination [(PUBMED:15944401)].
GO process:synaptonemal complex assembly (GO:0007130), synaptonemal complex organization (GO:0070193), meiotic prophase I (GO:0007128)
GO component:synaptonemal complex (GO:0000795)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SYCE1