The domain within your query sequence starts at position 89 and ends at position 237; the E-value for the SYF2 domain shown below is 9.8e-60.
ARGEDYEKVKLLEISAEDAERWERRKKKKNPDLGFSDYAAAQLRQYHRLTKQIKPDMESY ERQREKHGEDFFPTSNSLLHGTHVPSSEEIDRMVLDLEKQIEKRDKYSRRRPYNDDADID YINERNAKFNKKAERFYGKYTAEIKQNLE
SYF2 |
---|
PFAM accession number: | PF08231 |
---|---|
Interpro abstract (IPR013260): | Proteins in this entry are involved in cell cycle progression and pre-mRNA splicing [ (PUBMED:12384582) (PUBMED:11102353) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SYF2