The domain within your query sequence starts at position 89 and ends at position 237; the E-value for the SYF2 domain shown below is 9.8e-60.

ARGEDYEKVKLLEISAEDAERWERRKKKKNPDLGFSDYAAAQLRQYHRLTKQIKPDMESY
ERQREKHGEDFFPTSNSLLHGTHVPSSEEIDRMVLDLEKQIEKRDKYSRRRPYNDDADID
YINERNAKFNKKAERFYGKYTAEIKQNLE

SYF2

SYF2
PFAM accession number:PF08231
Interpro abstract (IPR013260):

Proteins in this entry are involved in cell cycle progression and pre-mRNA splicing [(PUBMED:12384582), (PUBMED:11102353)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SYF2