The domain within your query sequence starts at position 602 and ends at position 916; the E-value for the Sacchrp_dh_C domain shown below is 1.2e-88.

GLDPGLDHMLAMETIDTAKELGATVESYVSYCGGLPAPEHSDNPLRYKFSWSPVGVLMNI
MQPASYLLNGKVVNVTGGVSFLNSVTPMDYFPGLNLEGYPNRDSIKYAEIYGISSAHTLL
RGTLRYKGYSKALNGFVKLGLINREAYPALRPEANPLTWKQLLCDLVGISRSSPCEKLKE
VVFTKLGGDNTQLEAAEWLGLLGDEQVPQAESIVDAFSKHLVSKLSYGPEEKDMIVMRDS
FGIRHPSGHLENKTIDLVVYGDFNGFSAMAKTVGLPTAMAAKMLLDGEIEAKGLMGPFTK
EIYGPILERIKAEGI

Sacchrp_dh_C

Sacchrp_dh_C
PFAM accession number:PF16653
Interpro abstract (IPR032095):

This entry represents the C-terminal domain of saccharopine dehydrogenase and related proteins. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase [(PUBMED:8885833), (PUBMED:11080625)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sacchrp_dh_C