The domain within your query sequence starts at position 1107 and ends at position 1240; the E-value for the Sad1_UNC domain shown below is 9.2e-27.
RNLPYGRLEDILSRDNSALNCHSNDDKNAWFAIDLGVWVIPSAYTLRHARGYGRSALRNW VFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPAKDEKQGWRHVRLKQMGKNASGQT HYLSLSGFELYGTV
Sad1_UNC |
---|
PFAM accession number: | PF07738 |
---|---|
Interpro abstract (IPR012919): | Sad1/UNC-84 (SUN)-domain proteins are inner nuclear membrane (INM) proteins that are part of bridging complexes linking cytoskeletal elements with the nucleoskeleton. Originaly identified based on an ~150-amino acid region of homology between the C terminus of the Schizosaccharomyces pombe Sad1 protein and the Caenorhabditis elegans UNC-84 protein, SUN proteins are present in the proteomes of most eucaryotes. In addition to the SUN domain, these proteins contain a transmembrane sequence and at least one coiled-coil domain and localise to the inner nuclear envelope. SUN proteins are anchored in the inner nuclear envelope by their transmembrane segment and oriented in the membrane such that the C-terminal SUN domain is located in the space between the inner and outer nuclear membrane. Here, the SUN domain can interact with the C- terminal tail of an outer nuclear envelope protein that binds to the cytoskeleton, including the centrosome [ (PUBMED:15611647) (PUBMED:16923827) (PUBMED:19807882) ]. Some proteins known to contain a SUN domain are listed below:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sad1_UNC