SMART: Pfam domain Sarcoglycan

The domain within your query sequence starts at position 6 and ends at position 100; the E-value for the Sarcoglycan_2 domain shown below is 5.9e-34.

TWIPLLAGLLAGLRDTKAQQTTLHLLVGRVFVHPLEHATFLRLPEHVAVPPTVRLTYHAH
LQGHPDLPRWLHYTQRSPYNPGFLYGSPTPEDRGY

Sarcoglycan_2

PFAM accession number:	PF05510
Interpro abstract (IPR008908):	This entry contains alpha and epsilon sarcoglycans. The sarcoglycan family proteins are single pass transmembrane proteins that are part of the dystrophin-associated glycoprotein complex (DGC), a multiprotein complex that links the actin cytoskeleton to the extracellular matrix in cardiac and skeletal muscle [ (PUBMED:11917091) ]. The DGC can be classified biochemically into three subcomplexes: the cytoplasmic subcomplex (contains dystrophin, the dystrobrevins and the syntrophins), the dystroglycan subcomplex and the sarcoglycan subcomplex. The function of the sarcoglycan subcomplex is not clear. However, mutations in alpha-, beta-, gamma- and delta-sarcoglycan cause different forms of autosomal recessive limb girdle muscular dystrophies (LGMD) demonstrating its importance for normal muscle function [ (PUBMED:17200151) ].
GO component:	sarcoglycan complex (GO:0016012)

PFAM accession number:

PF05510

Interpro abstract (IPR008908):

This entry contains alpha and epsilon sarcoglycans.

The sarcoglycan family proteins are single pass transmembrane proteins that are part of the dystrophin-associated glycoprotein complex (DGC), a multiprotein complex that links the actin cytoskeleton to the extracellular matrix in cardiac and skeletal muscle [ (PUBMED:11917091) ]. The DGC can be classified biochemically into three subcomplexes: the cytoplasmic subcomplex (contains dystrophin, the dystrobrevins and the syntrophins), the dystroglycan subcomplex and the sarcoglycan subcomplex. The function of the sarcoglycan subcomplex is not clear. However, mutations in alpha-, beta-, gamma- and delta-sarcoglycan cause different forms of autosomal recessive limb girdle muscular dystrophies (LGMD) demonstrating its importance for normal muscle function [ (PUBMED:17200151) ].

GO component:

sarcoglycan complex (GO:0016012)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sarcoglycan_2