The domain within your query sequence starts at position 395 and ends at position 468; the E-value for the Sas10 domain shown below is 1e-31.
QNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRKAKIRRRGQVREVRREEQRYSGE LSGIRAGVKKSIKL
Sas10 |
---|
PFAM accession number: | PF09368 |
---|---|
Interpro abstract (IPR018972): | Sas10 is an Essential subunit of U3-containing Small Subunit (SSU) processome complex involved in the production of the 18S rRNA and assembly of the small ribosomal subunit [ (PUBMED:12068309) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sas10