The domain within your query sequence starts at position 18 and ends at position 98; the E-value for the Sas10_Utp3 domain shown below is 1.3e-18.

LKNLQEQVMAVTAQIQALTTKVRAGTYSTEKGLSFLEVKDQLLLMYLMDLSHLILDKASG
ASLQGHPAVLRLVEIRTVLEK

Sas10_Utp3

Sas10_Utp3
PFAM accession number:PF04000
Interpro abstract (IPR007146):

This family contains Utp3 and LCP5 which are components of the U3 ribonucleoprotein complex [(PUBMED:12068309)]. It also includes the Homo sapiens (Human) C1D protein and Saccharomyces cerevisiae (Baker's yeast) YHR081W (rrp47), an exosome-associated protein required for the 3' processing of stable RNAs [(PUBMED:9611201)] and Sas10 which has been identified as a regulator of chromatin silencing [(PUBMED:12972615)]. This entry also includes the human protein Neuroguidin, an initiation factor 4E (eIF4E)-binding protein [(PUBMED:9611201)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sas10_Utp3