The domain within your query sequence starts at position 226 and ends at position 306; the E-value for the Sas10_Utp3 domain shown below is 5.1e-21.

IEDLQAKLTEVKDELEPLLQLVEKGVIPTGRGSEYLKTKYNLYLNYCANISFYLILKARR
VPAHGHPVIERLVTYRNLINK

Sas10_Utp3

Sas10_Utp3
PFAM accession number:PF04000
Interpro abstract (IPR007146):

This family contains Utp3 and LCP5 which are components of the U3 ribonucleoprotein complex [ (PUBMED:12068309) ]. It also includes the Homo sapiens (Human) C1D protein and Saccharomyces cerevisiae (Baker's yeast) YHR081W (rrp47), an exosome-associated protein required for the 3' processing of stable RNAs [ (PUBMED:9611201) ] and Sas10 which has been identified as a regulator of chromatin silencing [ (PUBMED:12972615) ]. This entry also includes the human protein Neuroguidin, an initiation factor 4E (eIF4E)-binding protein [ (PUBMED:9611201) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sas10_Utp3