The domain within your query sequence starts at position 47 and ends at position 269; the E-value for the Scramblase domain shown below is 1.5e-79.

QPSSFLPTATLPPGLEYLSQLDLIIIHQQVELLGMILGTETSNKYEIKNSLGQRIYFAVE
ESICFNRNVCSTLRACTLRITDNSGREVITVNRPLRCNSCWCPCYLQELEIQAPPGTIVG
YVAQKWGPFQPKFTIQNANKEDILKIIGPCTTCGCFGDVDFEVKTVDEKVTIGKISKYWS
GFVNDVFTNADNFGIHVPADLDVTLKAAMIGACFLFDFMFFEH

Scramblase

Scramblase
PFAM accession number:PF03803
Interpro abstract (IPR005552): Scramblase is palmitoylated and contains a potential protein kinase C phosphorylation site. Scramblase exhibits Ca2+-activated phospholipid scrambling activity in vitro. There are also possible SH3 and WW binding motifs. Scramblase is involved in the redistribution of phospholipids after cell activation or injury [(PUBMED:11487015)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Scramblase