The domain within your query sequence starts at position 45 and ends at position 190; the E-value for the Scs3p domain shown below is 2.2e-23.

PESYLSNKRNVLNVYFVKLAWAWTVCLLLPFIALTNYHLTGKTSLVLRRLSTLLVGTAIW
YICTALFSNIEHYTGSCYQSPALEGIRQEHRSKQQCHREGGFWHGFDISGHSFLLTFCAL
MIVEEMAVLHEVKTDRGHHLHAAITT

Scs3p

 Scs3p
PFAM accession number:PF10261
Interpro abstract (IPR019388):

This entry represents the fat storage-inducing transmembrane (FIT) family of proteins, which play an important role in lipid droplet accumulation. They are endoplasmic reticulum resident membrane proteins that induce lipid droplet accumulation in cell culture and when expressed in mouse liver [ (PUBMED:18160536) ]; they mediate the partitioning of triglyceride from the ER into cytosolic fatty droplets by an as-yet undetermined mechanism. The ability to store fat in the form of cytoplasmic triglyceride droplets is conserved from Saccharomyces cerevisiae to humans [ (PUBMED:18160536) ]. The FIT family of proteins are not involved in triglyceride biosynthesis [ (PUBMED:20520733) ].

FIT1 and FIT2 proteins are six-transmembrane-domain containing proteins with both the N and C termini residing in the cytosol. FIT2 is the more anciently conserved homologue of the FIT family; this family of proteins do not share sequence similarity to known proteins or domains.

GO process:lipid storage (GO:0019915)
GO component:endoplasmic reticulum membrane (GO:0005789)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Scs3p