The domain within your query sequence starts at position 12 and ends at position 132; the E-value for the Sdh_cyt domain shown below is 2.9e-20.
HCLRAHLNAQLCIRKWSLPMALSVCHRGSGIALSGGVSLFGLSALLLPGNFESYLMFVKS LCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLGKGLAIPQVWLSGVAVVVLAVLSSGG L
Sdh_cyt |
---|
PFAM accession number: | PF01127 |
---|---|
Interpro abstract (IPR000701): | Succinate dehydrogenase (SDH) is a membrane-bound complex of two main components: a membrane-extrinsic component composed of an FAD-binding flavoprotein and an iron-sulphur protein, and a hydrophobic component composed of a cytochrome b and a membrane anchor protein. The cytochrome b component is a mono-haem transmembrane protein [ (PUBMED:1447196) (PUBMED:8152421) (PUBMED:7616569) ] belonging to a family that includes:
These cytochromes are proteins of about 130 residues that comprise three transmembrane regions. There are two conserved histidines which may be involved in binding the haem group. This family also includes the subunit C (the cytochrome B subunit) of type B fumarate reductases [ (PUBMED:9210286) ]. |
GO function: | oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sdh_cyt