SMART: Pfam domain Sdh

The domain within your query sequence starts at position 46 and ends at position 166; the E-value for the Sdh_cyt domain shown below is 2.4e-28.

TSSNRPLSPHLTIYKWSLPMALSVCHRGSGIALSGGVSLFGLSALLLPGNFESYLMFVKS
LCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLGKGLAIPQVWLSGVAVVVLAVLSSGG
L

Sdh_cyt

PFAM accession number:	PF01127
Interpro abstract (IPR000701):	Succinate dehydrogenase (SDH) is a membrane-bound complex of two main components: a membrane-extrinsic component composed of an FAD-binding flavoprotein and an iron-sulphur protein, and a hydrophobic component composed of a cytochrome b and a membrane anchor protein. The cytochrome b component is a mono-haem transmembrane protein [ (PUBMED:1447196) (PUBMED:8152421) (PUBMED:7616569) ] belonging to a family that includes: Cytochrome b-556 from bacterial SDH (gene sdhC). Cytochrome b560 from the mammalian mitochondrial SDH complex, which is encoded in the mitochondrial genome of some algae and in the plant Marchantia polymorpha. Cytochrome b from yeast mitochondrial SDH complex (gene SDH3 or CYB3). Protein cyt-1 from Caenorhabditis elegans. These cytochromes are proteins of about 130 residues that comprise three transmembrane regions. There are two conserved histidines which may be involved in binding the haem group. This family also includes the subunit C (the cytochrome B subunit) of type B fumarate reductases [ (PUBMED:9210286) ].
GO function:	oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627)

PFAM accession number:

PF01127

Interpro abstract (IPR000701):

Succinate dehydrogenase (SDH) is a membrane-bound complex of two main components: a membrane-extrinsic component composed of an FAD-binding flavoprotein and an iron-sulphur protein, and a hydrophobic component composed of a cytochrome b and a membrane anchor protein. The cytochrome b component is a mono-haem transmembrane protein [ (PUBMED:1447196) (PUBMED:8152421) (PUBMED:7616569) ] belonging to a family that includes:

Cytochrome b-556 from bacterial SDH (gene sdhC).
Cytochrome b560 from the mammalian mitochondrial SDH complex, which is encoded in the mitochondrial genome of some algae and in the plant Marchantia polymorpha.
Cytochrome b from yeast mitochondrial SDH complex (gene SDH3 or CYB3).
Protein cyt-1 from Caenorhabditis elegans.

These cytochromes are proteins of about 130 residues that comprise three transmembrane regions. There are two conserved histidines which may be involved in binding the haem group.

This family also includes the subunit C (the cytochrome B subunit) of type B fumarate reductases [ (PUBMED:9210286) ].

GO function:

oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sdh_cyt