SMART: Pfam domain Sds3

The domain within your query sequence starts at position 61 and ends at position 217; the E-value for the Sds3 domain shown below is 1.5e-27.

CLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVA
GIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSE
LWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQD

Sds3

PFAM accession number:	PF08598
Interpro abstract (IPR013907):	Repression of gene transcription is mediated by histone deacetylases containing repressor-co-repressor complexes, which are recruited to promoters of target genes via interactions with sequence-specific transcription factors. The co-repressor complex contains a core of at least seven proteins [ (PUBMED:15451426) ]. This entry represents the conserved region found in Sds3, Dep1 and BRMS1-homologue p40 proteins.

PFAM accession number:

PF08598

Interpro abstract (IPR013907):

Repression of gene transcription is mediated by histone deacetylases containing repressor-co-repressor complexes, which are recruited to promoters of target genes via interactions with sequence-specific transcription factors. The co-repressor complex contains a core of at least seven proteins [ (PUBMED:15451426) ]. This entry represents the conserved region found in Sds3, Dep1 and BRMS1-homologue p40 proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sds3