The domain within your query sequence starts at position 394 and ends at position 612; the E-value for the Sec16_C domain shown below is 1.3e-7.

LLSQALLLGELRSAVELCLKEERFADAIILAQAGDAELLKWTQERYLAKRRTKTSSLLAC
VVKKNWKDLVCACRLKNWREALALLLTYSGPEKFPELCDMLGTRMEQEGGRALTSEARLC
YVCSGSVERLVESWAKFQQASSPMALQELMEQVTVLSRSLELLQGSNKMSPGPATTHRLT
QYANLLAAQGSLATAMSFLPSDCIQPGVQQLRDRLFHAQ

Sec16_C

Sec16_C
PFAM accession number:PF12931
Interpro abstract (IPR024298):

Sec31 is a component of the COPII coat complex that mediates formation of transport vesicles from the ER. The central alpha-helical unit of Sec31 is structurally similar to four large architectural nucleoporins. This alpha-helical unit, common to COPII and nuclear pore complex proteins, has been termed the ancestral coatomer element 1 (ACE1) [(PUBMED:18974315)].

This entry represents the ACE1 element found in Sec31 and Sec16, which also contains an ACE1 [(PUBMED:20696705)]. The ACE1 element of Sec31 can functionally replace that of Sec16. Both Sec31 and Sec16 bind to Sec13 [(PUBMED:20696705)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec16_C