The domain within your query sequence starts at position 133 and ends at position 224; the E-value for the Sec20 domain shown below is 2.3e-37.

QTSSSITESLMGISRMMSQQVQQSEEAMQTLVSSSRTLLDANEEFKSMSGTIQLGRKLIT
KYNRRELTDKLLIFLALALFLATVLYIVKKRL

Sec20

Sec20
PFAM accession number:PF03908
Interpro abstract (IPR005606):

Sec20 is a membrane glycoprotein associated with secretory pathway.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec20