The domain within your query sequence starts at position 99 and ends at position 190; the E-value for the Sec20 domain shown below is 1.4e-38.
QTSSSITESLMGISRMMSQQVQQSEEAMQTLVSSSRTLLDANEEFKSMSGTIQLGRKLIT KYNRRELTDKLLIFLALALFLATVLYIVKKRL
Sec20 |
 |
|---|
| PFAM accession number: | PF03908 |
|---|---|
| Interpro abstract (IPR005606): | Sec20 is a membrane glycoprotein and a SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) involved in retrograde transport from the Golgi to the endoplasmic reticulum (ER) [ (PUBMED:1537327) ]. It is also required for N- and O-glycosylation in the Golgi [ (PUBMED:11477110) ]. |
| GO process: | retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum (GO:0006890) |
| GO function: | SNAP receptor activity (GO:0005484) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec20