SMART: Pfam domain Sec3-PIP2

The domain within your query sequence starts at position 41 and ends at position 89; the E-value for the Sec3-PIP2_bind domain shown below is 3.8e-14.

QGEYLTYICLSVTNKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVN

Sec3-PIP2_bind

PFAM accession number:	PF15277
Interpro abstract (IPR028258):	This is the N-terminal domain of fungal and eukaryotic Sec3 proteins. Sec3 is a component of the exocyst complex that is involved in the targeting and tethering of post-Golgi secretory vesicles to fusion sites on the plasma membrane prior to SNARE-mediated fusion. This N-terminal domain contains a cryptic pleckstrin homology (PH) fold, and all six positively charged lysine and arginine residues in the PH domain predicted to bind the phosphatidylinositol 4,5-bisphosphate (PIP2) head group are conserved. In fission yeast, polarised exocytosis for growth relies on the combined action of the exocyst at cell poles and myosin-driven transport along actin cables [ (PUBMED:22768263) ].

PFAM accession number:

PF15277

Interpro abstract (IPR028258):

This is the N-terminal domain of fungal and eukaryotic Sec3 proteins. Sec3 is a component of the exocyst complex that is involved in the targeting and tethering of post-Golgi secretory vesicles to fusion sites on the plasma membrane prior to SNARE-mediated fusion. This N-terminal domain contains a cryptic pleckstrin homology (PH) fold, and all six positively charged lysine and arginine residues in the PH domain predicted to bind the phosphatidylinositol 4,5-bisphosphate (PIP2) head group are conserved. In fission yeast, polarised exocytosis for growth relies on the combined action of the exocyst at cell poles and myosin-driven transport along actin cables [ (PUBMED:22768263) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec3-PIP2_bind