SMART: Pfam domain Sec39

The domain within your query sequence starts at position 725 and ends at position 1375; the E-value for the Sec39 domain shown below is 3.8e-34.

VLSARTYARESNVQALEILLTYHGSHLLPHRLAILSNFPETTSPHEYAVLLPEACWNNDS
LTIIPWAEHKHRAEDWCEELECRMVVEPSLQDDSEFLYAAQPELLQYRTPQLTVEKVMAW
YQSRAEDIEHHAGQVDCALSLVRLGVERHIPGLLTLCDDLVTLETLVYEAGCDFTLTLKD
LQQMKDFEKLRLLMEHCSEDNYVTSAYQWMVPFLHRCEKQSPGAANELLREYLVTLAKGD
LKLPLKIFQHSKPDLQQKIIPDEDQLMAIALECIYNCERSDQLSLCYDILECLPQRGCGH
NTKVTSSLHDMVDQLEKILSVSELLKTHGLEKPVSFVKNTQSSSEEARSLMVRLTRHTGR
KQPSVGESHWRMLLQDMLTMQQHVYTCLDSSACYEIFTESLLCSSRLENIHLAGQMMQCS
ACLDNPPAGALHKGRAQYRVSYERSIDLVLAASREYFNSSTNLTDSCMDLARCCLQLITD
RPAAIQEELDLIQALGYLEEFGVKTLPLQVRLCSDRISLIKECVSQSPTCYKQSAKLLGL
AELLRVAGEDPEGRRGQVLILLVEQALHVHDYKVASMYCQQLMAAGYPESWAVCSQLGQS
EGYQDLATRQELMAFALTHCPPSSIELLLEASSSLQTEILYQRVNFEIHPE

Sec39

PFAM accession number:	PF08314
Interpro abstract (IPR013244):	This entry represents a Sec39 domain, which can be found in yeast Sec39, human NBAS (neuroblastoma-amplified sequence) [ (PUBMED:12706883) ] and Arabidopsis MIP2 (MAG2-INTERACTING PROTEIN 2) [ (PUBMED:24118572) ]. They may be involved in Golgi-to-ER transport. Sec39 was originally identified as a protein involved in ER-Golgi transport in a large scale promoter shut down analysis of essential yeast genes [ (PUBMED:15242642) ]. A subsequent study found that Sec39p (Dsl3p) is required for Golgi-ER retrograde transport and is part of a very stable protein complex that also includes Dsl1p (in mammals ZW10), Tip20p (Rint-1) and the ER localized Q-SNARE proteins Ufe1p (syntaxin-18), Sec20p and Use1p [ (PUBMED:15242642) ]. This was confirmed in a genome-wide analysis of protein complexes [ (PUBMED:16429126) ].
GO process:	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum (GO:0006890)

PFAM accession number:

PF08314

Interpro abstract (IPR013244):

This entry represents a Sec39 domain, which can be found in yeast Sec39, human NBAS (neuroblastoma-amplified sequence) [ (PUBMED:12706883) ] and Arabidopsis MIP2 (MAG2-INTERACTING PROTEIN 2) [ (PUBMED:24118572) ]. They may be involved in Golgi-to-ER transport.

Sec39 was originally identified as a protein involved in ER-Golgi transport in a large scale promoter shut down analysis of essential yeast genes [ (PUBMED:15242642) ]. A subsequent study found that Sec39p (Dsl3p) is required for Golgi-ER retrograde transport and is part of a very stable protein complex that also includes Dsl1p (in mammals ZW10), Tip20p (Rint-1) and the ER localized Q-SNARE proteins Ufe1p (syntaxin-18), Sec20p and Use1p [ (PUBMED:15242642) ]. This was confirmed in a genome-wide analysis of protein complexes [ (PUBMED:16429126) ].

GO process:

retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum (GO:0006890)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec39