The domain within your query sequence starts at position 1 and ends at position 111; the E-value for the Sec3_C domain shown below is 1.7e-35.

KVDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEEVK
ISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFING

Sec3_C

Sec3_C
PFAM accession number:PF09763
Interpro abstract (IPR019160):

This entry represents the C-terminal domain of Sec3 (also known as Exoc1), a component of the exocyst complex (composed of Exoc1, Exoc2, Exoc3, Exoc4, Exoc5, Exoc6, Exoc7 and Exoc8).

Sec3 binds to the C-terminal cytoplasmic domain of GLYT1 (glycine transporter protein 1). Sec3 is the exocyst component that is closest to the plasma membrane docking site and it serves as a spatial landmark in the plasma membrane for incoming secretory vesicles. Sec3 is recruited to the sites of polarised membrane growth through its interaction with Rho1p, a small GTP-binding protein [ (PUBMED:16181645) ].

GO process:exocytosis (GO:0006887)
GO component:exocyst (GO:0000145)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec3_C