The domain within your query sequence starts at position 101 and ends at position 275; the E-value for the Sec5 domain shown below is 1.6e-19.

DSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLATNMAVITNFSARISATLQDR
HERITKLAGVHALLRKLQFLFELPSRLTKCVELGAYGQAVRYQGRARAVLQQYQHLPSFR
AIQDDCQVITARLAQQLRQRFREGCSGAPEQAECVELLLALGEPAEELCEEFLAH

Sec5

Sec5
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec5