The domain within your query sequence starts at position 198 and ends at position 377; the E-value for the Sec5 domain shown below is 3.6e-59.

SEGSLAYVKGGLSTFFEAQDALSAIHQKLEADGTEKVEGSMTQKLENVLNRASNTADTLF
QEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIKRNIQKGDYDVVINDYEKAKSLFGKTE
VQVFKKYYAEVEAGIEDLRELLLKKLLETPSTLHDQKRYIRYLSDLHAPGDPAWQCIGAQ

Sec5

Sec5
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec5