The domain within your query sequence starts at position 187 and ends at position 743; the E-value for the Sec6 domain shown below is 1.7e-162.

FGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFV
PPGRPKNWKEKMFAILDRTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNL
MVQCFPPHYEIFKNLLSMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYTSAEMMGNV
ELAPEVDVSALEPLLSPNIVSELLDTYMSTLTSNIIAWLRKALETDKKDWSKETEPEADQ
DGYYQTTLPAIVFQMFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSRYKDEAQLYKEEH
LRNRQHPHCYVQYMIAIINNCQTFKESIISLKRKYLKTEAEEGLCLSQPSMDGILDAIAK
EGCSSLLEEVFLDLEQHLNELMTKKWLLGSNAVDIICVTVEDYFNDFAKIKKPYKKRMTA
EAHRRVVVEYLRAVMQKRISFRSAEERKEGAEKMVREAEQLRFLFRKLASGFGEDADGHC
DTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLALRGDASRDMKQTIMETLE
QGPMQASPNYVPIFKEI

Sec6

Sec6
PFAM accession number:PF06046
Interpro abstract (IPR010326):

Sec6 is a component of the multiprotein exocyst complex. Sec6 interacts with Sec8, Sec10 and Exo70.These exocyst proteins localise to regions of active exocytosis-at the growing ends of interphase cells and in the medial region of cells undergoing cytokinesis-in an F-actin-dependent and exocytosis- independent manner [(PUBMED:11854409)].

GO process:exocytosis (GO:0006887)
GO component:exocyst (GO:0000145)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec6