The domain within your query sequence starts at position 13 and ends at position 70; the E-value for the Sec7 domain shown below is 5.9e-9.
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGD
Sec7 |
---|
PFAM accession number: | PF01369 |
---|---|
Interpro abstract (IPR000904): | Protein containing this domain are highly divergent in their overall sequence, however, they share a common region of roughly 200 amino acids known as the SEC7 domain. The 3D structure of the domain displays several alpha-helices [ (PUBMED:9653114) ]. It was found to be associated with other domains involved in guanine nucleotide exchange (e.g., CDC25, Dbl) in mammalian guanine-nucleotide-exchange factors [ (PUBMED:9868368) ]. SEC7 domain containing proteins are guanine nucleotide exchange factors (GEFs) specific for the ADP-rybosylation factors (ARF), a Ras-like GTPases which is important for vesicular protein trafficking. These proteins can be divided into five families, based on domain organisation and conservation of primary amino acid sequence: GBF/BIG, cytohesins,eFA6, BRAGs, and F-box [ (PUBMED:24728583) ]. They are found in all eukaryotes, and are involved in membrane remodeling processes throughout the cell [ (PUBMED:19669794) ]. |
GO process: | regulation of ARF protein signal transduction (GO:0032012) |
GO function: | ARF guanyl-nucleotide exchange factor activity (GO:0005086) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec7