The domain within your query sequence starts at position 416 and ends at position 575; the E-value for the Sec7_N domain shown below is 1.3e-52.

LQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPVFRTNEMFI
NAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETS
TSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANI

Sec7_N

Sec7_N
PFAM accession number:PF12783
Interpro abstract (IPR032691):

This entry represent a domain found towards the N terminus in guanine nucleotide exchange factors involved Golgi transport, such as budding yeast protein Sec7 and protein Mon2.

Sec7 and its homologues are guanine nucleotide exchange factors (GEFs) involved in the secretory pathway [(PUBMED:23386609)]. The full-length Sec7 functions proximally in the secretory pathway as a protein binding scaffold for the coat protein complexes COPII-COPI [(PUBMED:3042778)]. The COPII-COPI-protein switch is necessary for maturation of the vesicular-tubular cluster, VTC, intermediate compartments for Golgi compartment biogenesis. This N-terminal domain however does not appear to be binding either of the COP or the ARF [(PUBMED:11208097)].

Mon2 is distantly related to the Arf1 guanine nucleotide exchange factors (GEFs), such as Sec7. However, it lacks the Sec7 domain that catalyses nucleotide exchange on Arf1. Instead, Mon2 acts as a scaffold to recruit the Golgi-localised pool of Dop1 [(PUBMED:16301316)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec7_N