The domain within your query sequence starts at position 24 and ends at position 144; the E-value for the Sec8_exocyst domain shown below is 7.4e-37.

LISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERI
TNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIEHKHVLNLLDEIENIKQVPQKLEQ
C

Sec8_exocyst

Sec8_exocyst
PFAM accession number:PF04048
Interpro abstract (IPR007191):

Sec8 is a component of the exocyst complex involved in the docking of exocystic vesicles with a fusion site on the plasma membrane. The exocyst complex is composed of Sec3, Sec5, Sec6, Sec8, Sec10, Sec15, Exo70 and Exo84.

GO process:protein transport (GO:0015031), vesicle docking involved in exocytosis (GO:0006904)
GO component:exocyst (GO:0000145)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec8_exocyst