The domain within your query sequence starts at position 9 and ends at position 136; the E-value for the Sedlin_N domain shown below is 1.7e-51.

IVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFN
EWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDR
KVQFLGKK

Sedlin_N

Sedlin_N
PFAM accession number:PF04628
Interpro abstract (IPR006722):

Trafficking protein particle complex subunit 2, also known as Sedlin, is a 140 amino-acid protein with a putative role in endoplasmic reticulum-to-Golgi transport [ (PUBMED:20498720) ]. Several missense mutations and deletion mutations in the SEDL gene, which result in protein truncation by frame shift, are responsible for spondyloepiphyseal dysplasia tarda, a progressive skeletal disorder (OMIM:313400) [ (PUBMED:11349230) ].

GO process:endoplasmic reticulum to Golgi vesicle-mediated transport (GO:0006888)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sedlin_N