The domain within your query sequence starts at position 525 and ends at position 562; the E-value for the Sel1 domain shown below is 7.2e-5.

VHLAMVRYHEGGRFCEKDEEWDRESAIFHLEHAADLGE

Sel1

Sel1
PFAM accession number:PF08238
Interpro abstract (IPR006597):

Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [ (PUBMED:8722778) ]. Mammalian homologues have since been identified although these mainly pancreatic proteins have yet to have a function assigned.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sel1