The domain within your query sequence starts at position 609 and ends at position 645; the E-value for the Sel1 domain shown below is 4.8e-2.
RHSMILVARAFDTGLNLSPDRCQDWSEALHWYNTALE
Sel1 |
---|
PFAM accession number: | PF08238 |
---|---|
Interpro abstract (IPR006597): | Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [ (PUBMED:8722778) ]. Mammalian homologues have since been identified although these mainly pancreatic proteins have yet to have a function assigned. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sel1