The domain within your query sequence starts at position 1 and ends at position 188; the E-value for the Selenoprotein_S domain shown below is 1.8e-97.

MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLYIVIQRLSLRLRALRQ
RQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWD
SMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPG
RRGPSSGG

Selenoprotein_S

Selenoprotein_S
PFAM accession number:PF06936
Interpro abstract (IPR009703):

This family consists of several mammalian selenoprotein S (SelS) sequences. SelS is a plasma membrane protein and is present in a variety of tissues and cell types. These proteins are involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins which participate in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner [ (PUBMED:12477932) ]. They probably serve as a linker between DER1, which mediates the retro-translocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination.

GO process:intracellular protein transport (GO:0006886)
GO component:integral component of endoplasmic reticulum membrane (GO:0030176)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Selenoprotein_S