SMART: Pfam domain Sen15

The domain within your query sequence starts at position 62 and ends at position 127; the E-value for the Sen15 domain shown below is 4.1e-11.

LVYLDLMESKSWHEVNCVGIPELQLICLLGTEIEGEGLQTVVPTPISASLSHNRIFLLED
DICPSW

Sen15

PFAM accession number:	PF09631
Interpro abstract (IPR018593):	The Sen15 subunit of the tRNA intron-splicing endonuclease is one of the two structural subunits of this heterotetrameric enzyme. Residues 36-157 of this subunit possess a novel homodimeric fold. Each monomer consists of three alpha-helices and a mixed antiparallel/parallel beta-sheet. Two monomers of Sen15 fold with two monomers of Sen34, one of the two catalytic subunits, to form an alpha2-beta2 tetramer as part of the functional endonuclease assembly [ (PUBMED:17166513) ].

PFAM accession number:

PF09631

Interpro abstract (IPR018593):

The Sen15 subunit of the tRNA intron-splicing endonuclease is one of the two structural subunits of this heterotetrameric enzyme. Residues 36-157 of this subunit possess a novel homodimeric fold. Each monomer consists of three alpha-helices and a mixed antiparallel/parallel beta-sheet. Two monomers of Sen15 fold with two monomers of Sen34, one of the two catalytic subunits, to form an alpha2-beta2 tetramer as part of the functional endonuclease assembly [ (PUBMED:17166513) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sen15